Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

transient receptor potential cation channel, subfamily C, member 4 associated protein, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant TRPC4AP.

Manufacturer:  Abnova Corporation H00026133A01

Catalog No. 89-004-583


Add to cart

Description

Description

Sequence: VANEESEHNQASIVFPPPGASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGHNQNCDCSPD
Specifications

Specifications

transient receptor potential cation channel, subfamily C, member 4 associated protein
Unconjugated
50% glycerol
NM_015638
C20orf188|TRRP4AP|TRUSS
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
26133
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant TRPC4AP.
TRPC4AP
Serum
TRPC4AP
TRPC4AP (NP_056453, 341 a.a. ~ 451 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human, Murine
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit