Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TSPAN1, Mouse, Clone: 3B4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TSPAN1.

Manufacturer:  Abnova Corporation H00010103M05

Catalog No. 89-024-812


Add to cart

Description

Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq

Sequence: YTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTN
Specifications

Specifications

TSPAN1
3B4
Mouse monoclonal antibody raised against a partial recombinant TSPAN1.
TSPAN1
Unpurified
TSPAN1
TSPAN1 (NP_005718, 110 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA, Western Blot
Unconjugated
In 1X PBS, pH 7.4
NM_005727
9030418M05Rik|NET-1|RP11-322N21.1|TSPAN-1
Mouse
IgG2a Kappa
RUO
Primary
10103
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit