TXK tyrosine kinase, Mouse, Clone: 2G10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TXK.

Supplier:  Abnova Corporation H00007294M02

Catalog No. 89-001-038

Description

Sequence: LIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWY

Specifications

• Antigen: TXK tyrosine kinase
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_003328
• Gene Symbols: TXK
• Immunogen: TXK (NP_003319, 131 a.a. ∼ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 2G10
• Description: Mouse monoclonal antibody raised against a partial recombinant TXK.
• Gene: TXK
• Gene Alias: BTKL/MGC22473/PSCTK5/PTK4/RLK/TKL
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 7294
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ