Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TXNIP Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Sheep, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP152909

Catalog No. NBP152909

Add to cart



TXNIP Polyclonal antibody specifically detects TXNIP in Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Sheep samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptides corresponding to TXNIP(thioredoxin interacting protein). The peptide sequence was selected from the C terminal of TXNIP (NP_006463). Peptide sequence: DTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP.
44 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 0.2-1 ug/ml
HHCPA78, THIF, thioredoxin binding protein 2, thioredoxin interacting protein, Thioredoxin-binding protein 2, thioredoxin-interacting protein, upregulated by 1,25-dihydroxyvitamin D-3, VDUP1EST01027, Vitamin D3 up-regulated protein 1
Immunogen affinity purified
Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only