Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-UBASH3B/STS1/Tula-2, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP192456

Catalog No. NBP192456


Add to cart

Description

Description

UBASH3B/STS1/Tula-2 Polyclonal antibody specifically detects UBASH3B/STS1/Tula-2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

UBASH3B/STS1/Tula-2
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Cbl-interacting protein p70, Cbl-interacting protein Sts-1, KIAA1959SH3 domain-containing 70 kDa protein, suppressor of T-cell receptor signaling1, nm23-phosphorylated unknown substrate, MGC15437, nm23-phosphorylated unknown substrate, P70, STS1EC 3.1.3.48, STS-1ubiquitin-associated and SH3 domain-containing protein B, Suppressor of T-cell receptor signaling 1, T-cell ubiquitin ligand 2, TULA-2, Tyrosine-protein phosphatase STS1/TULA2, ubiquitin associated and SH3 domain containing B
Rabbit
IgG
0.1 ml
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Affinity Purified
UBASH3B
This antibody was developed against Recombinant Protein corresponding to amino acids:AGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVR
Immunogen affinity purified
RUO
Primary
84959
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only