Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ubiquitin-like 4A, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human UBL4A protein.

Manufacturer:  Abnova Corporation H00008266B01

Catalog No. 89-006-551


Add to cart

Description

Description

Sequence: MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK
Specifications

Specifications

ubiquitin-like 4A
Unconjugated
No additive
NM_014235.2
DX254E|DXS254E|G6PD|GDX|UBL4
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
8266
Immunofluorescence, Western Blot
Mouse polyclonal antibody raised against a full-length human UBL4A protein.
UBL4A
Serum
UBL4A
UBL4A (NP_055050.1, 1 a.a. ~ 157 a.a) full-length human protein.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit