Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-WDR16, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP181947

Catalog No. NBP181947


Add to cart

Description

Description

WDR16 Polyclonal antibody specifically detects WDR16 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

WDR16
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
WD repeat domain 16, WD repeat-containing protein 16, WD40-repeat protein upregulated in HCC, WD40-repeat protein up-regulated in HCC, WDRPUHFLJ37528
Rabbit
IgG
0.1 ml
Protein Kinase, Signal Transduction
Primary
146845
Human
Immunohistochemistry, Immunohistochemistry (Paraffin)
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Affinity Purified
WDR16
This antibody was developed against Recombinant Protein corresponding to amino acids:FYLGTTTGDILKMNPRTKLLTDVGPAKDKFSLGVSAIRCLKMGGLLVGSGAGLLVFCKSPGYKPIKKIQLQGGITSITLRGEGHQFLVGTEESH
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only