Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Wnt-2b Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP153120

Catalog No. NBP153120


Add to cart

Description

Description

Wnt-2b Polyclonal antibody specifically detects Wnt-2b in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

Wnt-2b
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
WNT2B
Synthetic peptides corresponding to WNT2B (wingless-type MMTV integration site family, member 2B) The peptide sequence was selected from the middle region of WNT2B. Peptide sequence LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT.
Protein A purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Q5T6U1
Protein Wnt-13, protein Wnt-2b, wingless-type MMTV integration site family, member 2B, WNT13XWNT2, Xenopus, homolog of, XWNT2wingless-type MMTV integration site family, member 13
Rabbit
IgG
100ul
Stem Cell Signaling Pathway, Wnt Signaling Pathway
Primary
7482
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only