Wnt-2b Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153120

Catalog No. NBP153120

Description

Wnt-2b Polyclonal specifically detects Wnt-2b in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Wnt-2b
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Protein Wnt-13, protein Wnt-2b, wingless-type MMTV integration site family, member 2B, WNT13XWNT2, Xenopus, homolog of, XWNT2wingless-type MMTV integration site family, member 13
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q5T6U1
• Gene Symbols: WNT2B
• Immunogen: Synthetic peptides corresponding to WNT2B (wingless-type MMTV integration site family, member 2B) The peptide sequence was selected from the middle region of WNT2B. Peptide sequence LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT.
• Quantity: 100 μL
• Research Discipline: Stem Cell Signaling Pathway, Wnt Signaling Pathway
• Gene ID (Entrez): 7482
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

For Research Use Only