XKR3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP193461

Catalog No. NBP193461

Description

XKR3 Polyclonal specifically detects XKR3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: XKR3
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: expressed in testis, MGC57211, X Kell blood group precursor-related family, member 3, x Kell blood group-related 3, XK, Kell blood group complex subunit-related family, member 3, XK-related protein 3, XRG3, XTES
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 150165
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: XKR3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TIRNYHKWLKNLKQEKEETQVSITKRNTMLEREIAFSIRDNFMQQKAFK
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only