Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-XKR8, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP214699

Catalog No. NBP214699

Add to cart



XKR8 Polyclonal specifically detects XKR8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.


PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
RP11-460I13.3, XKR8 XK, Kell blood group complex subunit-related family, member 8, XRG8
0.1 ml
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunohistochemistry, Immunohistochemistry (Paraffin)
Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Affinity Purified
This antibody was developed against Recombinant Protein corresponding to amino acids: HPSCCWKPDPDQVDGARSLLSPEGYQLPQNRRMTHLAQKFFPKAKDEAAS PVKG
Immunogen affinity purified
Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only