Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-ZEB1, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP188845

 View more versions of this product

Catalog No. NBP188845


Add to cart

Description

Description

ZEB1 Polyclonal antibody specifically detects ZEB1 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

ZEB1
0.2 mg/mL
Western Blot 0.04-0.4 ug/ml, Chromatin Immunoprecipitation, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Gel Supershift Assay
P37275
AREB6MGC133261, delta-crystallin enhancer binding factor 1, DELTAEF1, FECD6, Negative regulator of IL2, NIL2A, NIL-2-A, NIL-2-A zinc finger protein, posterior polymorphous corneal dystrophy 3, PPCD3, TCF-8, TCF8BZP, Transcription factor 8, transcription factor 8 (represses interleukin 2 expression), ZEB, Zfhep, ZFHX1A, zinc finger E-box binding homeobox 1, zinc finger E-box-binding homeobox 1, zinc finger homeodomain enhancer-binding protein
Rabbit
IgG
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Affinity Purified
ZEB1
This antibody was developed against Recombinant Protein corresponding to amino acids:EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST
124 kDa
0.1 ml
Cancer, Chromatin Research, Signal Transduction, Transcription Factors and Regulators, Zinc Finger
Primary
6935
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only