Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

zinc finger protein 593, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human ZNF593 protein.

Manufacturer:  Abnova Corporation H00051042B01

Catalog No. 89-007-577


Add to cart

Description

Description

Sequence: MKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSANLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST
Specifications

Specifications

zinc finger protein 593
Unconjugated
No additive
BC002580
ZT86
Mouse
50 uL
Transcription Regulation
Y
Polyclonal
Human
Immunofluorescence, Western Blot
Mouse polyclonal antibody raised against a full-length human ZNF593 protein.
ZNF593
Serum
ZNF593
ZNF593 (AAH02580, 1 a.a. ~ 116 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
51042
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit