Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AOC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP162442
Description
AOC2 Polyclonal specifically detects AOC2 in Human samples. It is validated for Western Blot.Specifications
AOC2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Amine oxidase [copper-containing], amine oxidase, copper containing 2 (retina-specific), DAO2, EC 1.4.3, RAOEC 1.4.3.21, retina-specific copper amine oxidase, Semicarbazide-sensitive amine oxidase, SSAO | |
Rabbit | |
84 kDa | |
100 μL | |
Vision | |
314 | |
Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
O75106 | |
AOC2 | |
Synthetic peptides corresponding to AOC2(amine oxidase, copper containing 2 (retina-specific)) The peptide sequence was selected from the middle region of AOC2 (NP_033720). Peptide sequence QATMVDIHILVGKGAVQLLPGAVCVFEEAQGLPLRRHHNYLQNHFYGGLA. | |
Affinity purified | |
RUO | |
Primary | |
Rat: 83%; Guinea pig: 83%. | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction