AP3M2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NBP156624	Novus Biologicals NBP156624	100 μL

Description

AP3M2 Polyclonal specifically detects AP3M2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AP3M2
• Classification: Polyclonal
• Host Species: Rabbit
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Adapter-related protein complex 3 mu-2 subunit, adaptor-related protein complex 3, mu 2 subunit, AP-3 complex subunit mu-2, AP47B, CLA20, Clathrin assembly protein assembly protein complex 1 medium chain homolog 2, Clathrin coat assembly protein AP47 homolog 2, Clathrin coat-associated protein AP47 homolog 2, clathrin-associated protein AP47 homolog 2, Golgi adaptor AP-1 47 kDa protein homolog 2, HA1 47 kDa subunit homolog 2, HA1 47kDA subunit homolog 2, mu3B-adaptin, P47B
• Gene Symbols: AP3M2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: This product is specific to Subunit or Isoform: mu-2.

• Applications: Western Blot
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Gene Accession No.: P53677
• Gene ID (Entrez): 10947
• Immunogen: Synthetic peptides corresponding to AP3M2(adaptor-related protein complex 3, mu 2 subunit) The peptide sequence was selected from the middle region of AP3M2 (NP_006794). Peptide sequence VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID.
• Primary or Secondary: Primary
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Molecular Weight of Antigen: 47 kDa