Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AP3M2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$436.00

Specifications

Antigen AP3M2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP156624
View Documents
Novus Biologicals
NBP156624
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

AP3M2 Polyclonal specifically detects AP3M2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

AP3M2
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
Adapter-related protein complex 3 mu-2 subunit, adaptor-related protein complex 3, mu 2 subunit, AP-3 complex subunit mu-2, AP47B, CLA20, Clathrin assembly protein assembly protein complex 1 medium chain homolog 2, Clathrin coat assembly protein AP47 homolog 2, Clathrin coat-associated protein AP47 homolog 2, clathrin-associated protein AP47 homolog 2, Golgi adaptor AP-1 47 kDa protein homolog 2, HA1 47 kDa subunit homolog 2, HA1 47kDA subunit homolog 2, mu3B-adaptin, P47B
AP3M2
IgG
Affinity Purified
This product is specific to Subunit or Isoform: mu-2.
Western Blot
Unconjugated
RUO
P53677
10947
Synthetic peptides corresponding to AP3M2(adaptor-related protein complex 3, mu 2 subunit) The peptide sequence was selected from the middle region of AP3M2 (NP_006794). Peptide sequence VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID.
Primary
Store at -20C. Avoid freeze-thaw cycles.
47 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit