Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AP3S1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$152.22 - $436.00

Specifications

Antigen AP3S1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15544920
View Documents
Novus Biologicals
NBP15544920UL
20 μL
Each for $152.22
Add to cart
 
NBP155449
View Documents
Novus Biologicals
NBP155449
100 μL
Each for $436.00
Add to cart
 
Description

Description

AP3S1 Polyclonal specifically detects AP3S1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

AP3S1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
Adapter-related protein complex 3 sigma-1 subunit, adaptor-related protein complex 3, sigma 1 subunit, AP-3 complex sigma-3A subunit, AP-3 complex subunit sigma-3A, CLAPS3AP-3 complex subunit sigma-1, Clathrin-associated/assembly/adapter protein, small 3, clathrin-associated/assembly/adaptor protein, small 3 (22kD), Sigma3A, sigma-3A-adaptin, Sigma3A-adaptin, Sigma-adaptin 3a
AP3S1
IgG
Affinity Purified
22 kDa
Western Blot
Unconjugated
RUO
Q92572
1176
Synthetic peptides corresponding to AP3S1(adaptor-related protein complex 3, sigma 1 subunit) The peptide sequence was selected from the N terminal of AP3S1 (NP_001275). Peptide sequence IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit