AP3S1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NBP15544920	Novus Biologicals NBP15544920UL	20 μL
NBP155449	Novus Biologicals NBP155449	100 μL

Description

AP3S1 Polyclonal specifically detects AP3S1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AP3S1
• Classification: Polyclonal
• Host Species: Rabbit
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Adapter-related protein complex 3 sigma-1 subunit, adaptor-related protein complex 3, sigma 1 subunit, AP-3 complex sigma-3A subunit, AP-3 complex subunit sigma-3A, CLAPS3AP-3 complex subunit sigma-1, Clathrin-associated/assembly/adapter protein, small 3, clathrin-associated/assembly/adaptor protein, small 3 (22kD), Sigma3A, sigma-3A-adaptin, Sigma3A-adaptin, Sigma-adaptin 3a
• Gene Symbols: AP3S1
• Isotype: IgG
• Purification Method: Affinity Purified
• Molecular Weight of Antigen: 22 kDa

• Applications: Western Blot
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Gene Accession No.: Q92572
• Gene ID (Entrez): 1176
• Immunogen: Synthetic peptides corresponding to AP3S1(adaptor-related protein complex 3, sigma 1 subunit) The peptide sequence was selected from the N terminal of AP3S1 (NP_001275). Peptide sequence IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE.
• Primary or Secondary: Primary
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.