AP4M1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310704100UL

Catalog No. NB126309

Description

AP4M1 Polyclonal specifically detects AP4M1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AP4M1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: Adapter-related protein complex 4 mu-1 subunit, adaptor-related protein complex 4, mu 1 subunit, adaptor-related protein complex AP-4 mu4 subunit, AP-4 adapter complex mu subunit, AP-4 complex subunit mu-1, CPSQ3, Mu subunit of AP-4, mu4, MU-4, Mu4-adaptin, Mu-adaptin-related protein 2, mu-adaptin-related protein-2, MUARP2, MU-ARP2
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AP4M1 (NP_004713). Peptide sequence QELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLS
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9179
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.