Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
APBA1 Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | APBA1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
APBA1 Polyclonal specifically detects APBA1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| APBA1 | |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| Rabbit | |
| Membrane Trafficking and Chaperones, Vision | |
| PBS buffer, 2% sucrose | |
| 320 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Rat | |
| Adapter protein X11alpha, amyloid beta (A4) precursor protein-binding, family A, member 1, amyloid beta A4 precursor protein-binding family A member 1, D9S411Eadaptor protein X11alpha, LIN10, Mint-1, MINT1amyloid beta (A4) precursor protein-binding, family A, member 1 (X11), Neuronal Munc18-1-interacting protein 1, Neuron-specific X11 protein, phosphotyrosine-binding/-interacting domain (PTB)-bearing protein, UROP11, X11A, X11X11ALPHA | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human APBA1 (EAW62487). Peptide sequence PPQQQHYVGRHQRGRALEDLRAQLGQEEEERGECLARSASTESGFHNHTD | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title