Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

APBB3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen APBB3
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126467
View Documents
Novus Biologicals
NBP310783100UL
100 μg
Each for $352.89
Add to cart
 
NB126468
View Documents
Novus Biologicals
NBP31078325UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

APBB3 Polyclonal antibody specifically detects APBB3 in Human samples. It is validated for Western Blot
Specifications

Specifications

APBB3
Western Blot
Purified
RUO
Human
amyloid beta (A4) precursor protein-binding, family B, member 3, amyloid precursor interacting protein, Fe65L2, FE65L2amyloid beta A4 precursor protein-binding family B member 3, FE65-like protein 2, MGC150555, MGC87674, Protein Fe65-like 2, SRA
The immunogen is a synthetic peptide directed towards the middle region of Human APBB3. Peptide sequence AQTRSRSQPPDGAWGEGQNMLMILKKDAMSLVNPLDHSLIHCQPLVHIRV
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Signal Transduction
PBS buffer, 2% sucrose
10307
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit