Apc10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158197

Catalog No. NBP158197

Description

Apc10 Polyclonal specifically detects Apc10 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Apc10
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: anaphase promoting complex subunit 10, anaphase-promoting complex subunit 10, APC10DOC1, Cyclosome subunit 10, DKFZP564L0562
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: 10.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UM13
• Gene Symbols: ANAPC10
• Immunogen: Synthetic peptides corresponding to ANAPC10(anaphase promoting complex subunit 10) The peptide sequence was selected from the N terminal of ANAPC10. Peptide sequence MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL.
• Quantity: 100 μL
• Research Discipline: Cell Biology, Cell Cycle and Replication, Ubiquitin Proteasome Pathway
• Gene ID (Entrez): 10393
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.