Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Apc10 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Apc10 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158197
|
Novus Biologicals
NBP158197 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Apc10 Polyclonal specifically detects Apc10 in Human samples. It is validated for Western Blot.Specifications
| Apc10 | |
| Polyclonal | |
| Rabbit | |
| Cell Biology, Cell Cycle and Replication, Ubiquitin Proteasome Pathway | |
| anaphase promoting complex subunit 10, anaphase-promoting complex subunit 10, APC10DOC1, Cyclosome subunit 10, DKFZP564L0562 | |
| ANAPC10 | |
| IgG | |
| Affinity Purified | |
| This product is specific to Subunit or Isoform: 10. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UM13 | |
| 10393 | |
| Synthetic peptides corresponding to ANAPC10(anaphase promoting complex subunit 10) The peptide sequence was selected from the N terminal of ANAPC10. Peptide sequence MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title