Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Apc10 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen Apc10
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP158197
View Documents
Novus Biologicals
NBP158197
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

Apc10 Polyclonal specifically detects Apc10 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Apc10
Polyclonal
Rabbit
Cell Biology, Cell Cycle and Replication, Ubiquitin Proteasome Pathway
anaphase promoting complex subunit 10, anaphase-promoting complex subunit 10, APC10DOC1, Cyclosome subunit 10, DKFZP564L0562
ANAPC10
IgG
Affinity Purified
This product is specific to Subunit or Isoform: 10.
Western Blot
Unconjugated
RUO
Q9UM13
10393
Synthetic peptides corresponding to ANAPC10(anaphase promoting complex subunit 10) The peptide sequence was selected from the N terminal of ANAPC10. Peptide sequence MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit