Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
APOBEC3B Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31083425UL
Description
APOBEC3B Polyclonal specifically detects APOBEC3B in Mouse samples. It is validated for Western Blot.Specifications
APOBEC3B | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
APOBEC1L, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B, ARCD3, ARP4, bK150C2.2, cytidine deaminase, DJ742C19.2, EC 3.5.4, EC 3.5.4.-, FLJ21201, phorbolin 3, Phorbolin-1-related protein, phorbolin-2/3, PHRBNLphorbolin 2, probable DNA dC->dU-editing enzyme APOBEC-3B | |
The immunogen is a synthetic peptide directed towards the middle region of mouse APOBEC3B. Peptide sequence AQVAAMDLYEFKKCWKKFVDNGGRRFRPWKRLLTNFRYQDSKLQEILRPC | |
25 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
9582 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction