APOBEC4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156380

Catalog No. NBP156380

Description

APOBEC4 Polyclonal specifically detects APOBEC4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: APOBEC4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8WW27
• Gene Symbols: APOBEC4
• Immunogen: Synthetic peptides corresponding to APOBEC4(apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 4 (putative)) The peptide sequence was selected from the N terminal of APOBEC4. Peptide sequence LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIIL The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 403314
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 4 (putative), Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 4, C1orf169, chromosome 1 open reading frame 169, EC 3.5.4.-, FLJ25691, MGC26594, putative C->U-editing enzyme APOBEC-4, RP1-127C7.4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 92%.
• Target Species: Human, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG