Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Apolipoprotein L5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | Apolipoprotein L5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17972520
|
Novus Biologicals
NBP17972520UL |
20 μL |
Each for $152.22
|
|
NBP179725
|
Novus Biologicals
NBP179725 |
100 μL |
Each for $436.00
|
|
Description
Apolipoprotein L5 Polyclonal specifically detects Apolipoprotein L5 in Human samples. It is validated for Western Blot.Specifications
| Apolipoprotein L5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| NP_085145 | |
| 80831 | |
| Synthetic peptide directed towards the C terminal of human APOL5. Peptide sequence: QHHRHLPQKASQTCSSSRGRAVRGSRVVKPEGSRSPLPWPVVEHQPRLGP | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| apolipoprotein L, 5, apolipoprotein L5, Apolipoprotein L-V, APOLV, APOL-V | |
| APOL5 | |
| IgG | |
| Affinity Purified | |
| 47 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title