Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Aquaporin-7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | Aquaporin-7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15438420
|
Novus Biologicals
NBP15438420UL |
20 μL |
Each for $152.22
|
|
NBP154384
|
Novus Biologicals
NBP154384 |
100 μL |
Each for $436.00
|
|
Description
Aquaporin-7 Polyclonal specifically detects Aquaporin-7 in Human samples. It is validated for Western Blot.Specifications
| Aquaporin-7 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| AQP-7, AQP7L, AQP9MGC149556, AQPapaquaglyceroporin-7, Aquaglyceroporin-7, aquaporin 7, Aquaporin adipose, aquaporin-7, Aquaporin-7-like, MGC149555 | |
| AQP7 | |
| IgG | |
| Affinity Purified | |
| 37 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O14520 | |
| 364 | |
| Synthetic peptides corresponding to AQP7 (aquaporin 7) The peptide sequence was selected from the C terminal of AQP7. Peptide sequence DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title