Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ARFGAP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen ARFGAP1
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126182
View Documents
Novus Biologicals
NBP31064025UL
25 μg
Each for $106.19
Add to cart
 
NB126181
View Documents
Novus Biologicals
NBP310640100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

ARFGAP1 Polyclonal antibody specifically detects ARFGAP1 in Human samples. It is validated for Western Blot
Specifications

Specifications

ARFGAP1
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
55738
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
ADP-ribosylation factor 1 GTPase activating protein, ADP-ribosylation factor 1 GTPase-activating protein, ADP-ribosylation factor GTPase activating protein 1, ADP-ribosylation factor GTPase-activating protein 1, ARF GAP 1, ARF1 GAP, ARF1-directed GTPase-activating protein, ARF1GAP, bA261N11.3, FLJ10767, GAP protein, HRIHFB2281, MGC39924
The immunogen is a synthetic peptide directed towards the middle region of human ARFGAP1 (NP_060679). Peptide sequence WRDVTTFFSGKAEGPLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAE
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit