Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ARGFX Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179220

 View more versions of this product

Catalog No. NBP179220


Add to cart

Description

Description

ARGFX Polyclonal antibody specifically detects ARGFX in Human, Yeast samples. It is validated for Western Blot.
Specifications

Specifications

ARGFX
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
ARGFX
Synthetic peptide directed towards the N terminal of human ARGFXThe immunogen for this antibody is ARGFX. Peptide sequence MFPDRNLQEKLALRLDLPESTVKVWFRNRRFKLKKQQQQQSAKQRNQILP.
Protein A purified
RUO
Primary
503582
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_001012677
arginine-fifty homeobox
Rabbit
IgG
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Yeast 83%.
Human, Yeast
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit