ARHGDIG Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159112

Catalog No. NBP159112

Description

ARHGDIG Polyclonal specifically detects ARHGDIG in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ARHGDIG
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q99819
• Gene Symbols: ARHGDIG
• Immunogen: Synthetic peptides corresponding to ARHGDIG (Rho GDP dissociation inhibitor (GDI) gamma) The peptide sequence was selected from the N terminal of ARHGDIG. Peptide sequence DEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPN.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 398
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: Rho GDI 3, Rho GDP dissociation inhibitor (GDI) gamma, rho GDP-dissociation inhibitor 3, RhoGDI gamma, Rho-GDI gamma, RHOGDI-3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human, Equine
• Isotype: IgG