Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARHGDIG Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ARHGDIG |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159112
|
Novus Biologicals
NBP159112 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ARHGDIG Polyclonal specifically detects ARHGDIG in Human samples. It is validated for Western Blot.Specifications
| ARHGDIG | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| Rho GDI 3, Rho GDP dissociation inhibitor (GDI) gamma, rho GDP-dissociation inhibitor 3, RhoGDI gamma, Rho-GDI gamma, RHOGDI-3 | |
| ARHGDIG | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q99819 | |
| 398 | |
| Synthetic peptides corresponding to ARHGDIG (Rho GDP dissociation inhibitor (GDI) gamma) The peptide sequence was selected from the N terminal of ARHGDIG. Peptide sequence DEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPN. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title