Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ARID1A Mouse anti-Human, Clone: CL3595, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus Biologicals NBP261623

Catalog No. NBP261623


Add to cart

Description

Description

ARID1A Monoclonal antibody specifically detects ARID1A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

ARID1A
CL3595
Western Blot 1 ug/ml, Immunohistochemistry 1:50 - 1:200
Purified
ARID1A
This antibody was developed against a recombinant protein corresponding to amino acids: PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK
Protein A purified
Signal Transduction
Primary
8289
Human
Immunohistochemistry, Western Blot
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
ARID domain-containing protein 1A, AT rich interactive domain 1A (SWI- like), AT rich interactive domain 1A (SWI-like), AT-rich interactive domain-containing protein 1A, B120SWI-like protein, BAF250a, BAF250SWI/SNF complex protein p270, BM029, brain protein 120, BRG1-associated factor 250, BRG1-associated factor 250a, C10rf4, C1orf4SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatinsubfamily F member 1, chromatin remodeling factor p250, hELD, hOSA1, matrix associated, actin dependent regulator of chromatin, Osa homolog 1, OSA1, OSA1 nuclear protein, P270, SMARCF1, subfamily f, member 1
Mouse
IgG1
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Monoclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit