Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ARID3C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179363

 View more versions of this product

Catalog No. NBP179363


Add to cart

Description

Description

ARID3C Polyclonal antibody specifically detects ARID3C in Human, Mouse, Rat, Porcine, Bovine, Canine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

ARID3C
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
ARID3C
Synthetic peptide directed towards the C terminal of human ARID3CThe immunogen for this antibody is ARID3C (NP_001017363). Peptide Sequence: MGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLAGSGISSINMALEING
44 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Canine: 100%; Rat: 100%; Bovine: 92%; Rabbit: 92%.
Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat
Western Blot
Western Blot 0.2-1 ug/ml
A6NKF2
ARID domain-containing protein 3C, AT rich interactive domain 3C (BRIGHT- like), AT rich interactive domain 3C (BRIGHT-like), AT-rich interactive domain-containing protein 3C
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
138715
Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit