Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ARID3C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen ARID3C
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17936320
View Documents
Novus Biologicals
NBP17936320UL
20 μL
Each for $152.22
Add to cart
 
NBP179363
View Documents
Novus Biologicals
NBP179363
100 μL
Each for $436.00
Add to cart
 
Description

Description

ARID3C Polyclonal specifically detects ARID3C in Human samples. It is validated for Western Blot.
Specifications

Specifications

ARID3C
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
ARID domain-containing protein 3C, AT rich interactive domain 3C (BRIGHT- like), AT rich interactive domain 3C (BRIGHT-like), AT-rich interactive domain-containing protein 3C
ARID3C
IgG
Affinity Purified
44 kDa
Western Blot
Unconjugated
RUO
A6NKF2
138715
Synthetic peptide directed towards the C terminal of human ARID3CThe immunogen for this antibody is ARID3C (NP_001017363). Peptide Sequence: MGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLAGSGISSINMALEING
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit