Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARID3C Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | ARID3C |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17936320
|
Novus Biologicals
NBP17936320UL |
20 μL |
Each for $152.22
|
|
NBP179363
|
Novus Biologicals
NBP179363 |
100 μL |
Each for $436.00
|
|
Description
ARID3C Polyclonal specifically detects ARID3C in Human samples. It is validated for Western Blot.Specifications
| ARID3C | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ARID domain-containing protein 3C, AT rich interactive domain 3C (BRIGHT- like), AT rich interactive domain 3C (BRIGHT-like), AT-rich interactive domain-containing protein 3C | |
| ARID3C | |
| IgG | |
| Affinity Purified | |
| 44 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| A6NKF2 | |
| 138715 | |
| Synthetic peptide directed towards the C terminal of human ARID3CThe immunogen for this antibody is ARID3C (NP_001017363). Peptide Sequence: MGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLAGSGISSINMALEING | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title