ARIH2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257992

Catalog No. NBP257992

Description

ARIH2 Polyclonal specifically detects ARIH2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ARIH2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: ARI-2, ariadne (Drosophila) homolog 2, ariadne homolog 2 (Drosophila), E3 ubiquitin-protein ligase ARIH2, EC 6.3.2.-, FLJ10938, FLJ33921, Protein ariadne-2 homolog, Triad1 protein, TRIAD1ARI2all-trans retinoic acid inducible RING finger
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10425
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ARIH2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RVQPNPSKHVPTSHPPHHCAVCMQFVRKENLLSLACQHQFCRSCWEQHCSVLVKDGVGVGVSCMAQDCPLRTPEDFVFPLL
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only