Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ARL13B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen ARL13B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15549820
View Documents
Novus Biologicals
NBP15549820UL
20 μL
Each for $152.22
N/A
NBP155498
View Documents
Novus Biologicals
NBP155498
100 μL
Each for $436.00
N/A
Description

Description

ARL13B Polyclonal specifically detects ARL13B in Human samples. It is validated for Western Blot.
Specifications

Specifications

ARL13B
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
200894
Synthetic peptides corresponding to ARL13B (ADP-ribosylation factor-like 13B) The peptide sequence was selected from the middle region of ARL13B. Peptide sequence RVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYR.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
ADP-ribosylation factor-like 13B, ADP-ribosylation factor-like 2-like 1, ADP-ribosylation factor-like protein 13B, ADP-ribosylation factor-like protein 2-like 1, ARL2L1MGC120611, ARL2-like protein 1, DKFZp686E2075, DKFZp686L2472, DKFZp761H079, JBTS8DKFZp686M2074, MGC120612
ARL13B
IgG
Affinity Purified
37 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit