Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARL13B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
| Antigen | ARL13B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15549820
|
Novus Biologicals
NBP15549820UL |
20 μL |
Each for $152.22
|
N/A |
NBP155498
|
Novus Biologicals
NBP155498 |
100 μL |
Each for $436.00
|
N/A |
Description
ARL13B Polyclonal specifically detects ARL13B in Human samples. It is validated for Western Blot.Specifications
| ARL13B | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 200894 | |
| Synthetic peptides corresponding to ARL13B (ADP-ribosylation factor-like 13B) The peptide sequence was selected from the middle region of ARL13B. Peptide sequence RVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ADP-ribosylation factor-like 13B, ADP-ribosylation factor-like 2-like 1, ADP-ribosylation factor-like protein 13B, ADP-ribosylation factor-like protein 2-like 1, ARL2L1MGC120611, ARL2-like protein 1, DKFZp686E2075, DKFZp686L2472, DKFZp761H079, JBTS8DKFZp686M2074, MGC120612 | |
| ARL13B | |
| IgG | |
| Affinity Purified | |
| 37 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title