Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ARMCX6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191581

 View more versions of this product

Catalog No. NBP191581


Add to cart

Description

Description

ARMCX6 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.
Specifications

Specifications

ARMCX6
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
ARMCX6
Synthetic peptide directed towards the N terminal of human ARMCX6 (NP_061880). Peptide sequence TMARPWTEDGDWTEPGAPGGTEDRPSGGGKANRAHPIKQRPFPYEHKNTW.
Protein A purified
RUO
Primary
54470
Centrifuge vial prior to reconstitution. Add 100μL distilled water to a final antibody concentration of 1mg/mL.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Western Blot 5 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Q7L4S7
armadillo repeat containing, X-linked 6, FLJ20811, protein ARMCX6
Rabbit
IgG
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Mouse: 100%; Human: 100%; Rat: 92%; Canine: 78%.
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit