ARMCX6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191581

Catalog No. NBP191581

Description

ARMCX6 Polyclonal specifically detects ARMCX6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ARMCX6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: armadillo repeat containing, X-linked 6, FLJ20811, protein ARMCX6
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54470
• Reconstitution: Centrifuge vial prior to reconstitution. Add 100μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
• Gene Accession No.: Q7L4S7
• Gene Symbols: ARMCX6
• Immunogen: Synthetic peptide directed towards the N terminal of human ARMCX6 (NP_061880). Peptide sequence TMARPWTEDGDWTEPGAPGGTEDRPSGGGKANRAHPIKQRPFPYEHKNTW.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 100%; Human: 100%; Rat: 92%; Canine: 78%.
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig
• Form: Purified