Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARMT1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | ARMT1 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB126359
|
Novus Biologicals
NBP310729100UL |
100 μg |
Each for $482.50
|
|
|||||
NB126360
|
Novus Biologicals
NBP31072925UL |
25 μg | Item Discontinued This item has been discontinued by the supplier. Please Sign In to view product availability in your area. | N/A | |||||
Description
ARMT1 Polyclonal specifically detects ARMT1 in Human samples. It is validated for Western Blot.Specifications
ARMT1 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
79624 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human C6orf211 (NP_078849). Peptide sequence SDGKSRWFYSPWLLVECYMYRRIHEAIIQSPPIDYFDVFKESKEQNFYGS | |
Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title