ARNTL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169002

Catalog No. NBP169002

Description

ARNTL2 Polyclonal specifically detects ARNTL2 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: ARNTL2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Aryl hydrocarbon receptor nuclear translocator-like protein 2, Basic-helix-loop-helix-PAS protein MOP9, bHLHe6, BMAL2, Brain and muscle ARNT-like 2, Class E basic helix-loop-helix protein 6, CLIF, CYCLE-like factor, Member of PAS protein 9, MOP9, PAS domain-containing protein 9, PASD9, Transcription Factor BMAL2
• Host Species: Rabbit
• Molecular Weight of Antigen: 64 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q2VPD4
• Gene Symbols: ARNTL2
• Immunogen: The immunogen for anti-Arntl2 antibody: synthetic peptide corresponding to a region of Mouse ARNTL2 (NP_758513). Peptide sequence AILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56938
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit
• Isotype: IgG