Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARNTL2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | ARNTL2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16900220
|
Novus Biologicals
NBP16900220UL |
20 μL |
Each for $152.22
|
|
NBP169002
|
Novus Biologicals
NBP169002 |
100 μL |
Each for $436.00
|
|
Description
ARNTL2 Polyclonal specifically detects ARNTL2 in Mouse samples. It is validated for Western Blot.Specifications
ARNTL2 | |
Polyclonal | |
Rabbit | |
Q2VPD4 | |
56938 | |
The immunogen for anti-Arntl2 antibody: synthetic peptide corresponding to a region of Mouse ARNTL2 (NP_758513). Peptide sequence AILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRV. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
Aryl hydrocarbon receptor nuclear translocator-like protein 2, Basic-helix-loop-helix-PAS protein MOP9, bHLHe6, BMAL2, Brain and muscle ARNT-like 2, Class E basic helix-loop-helix protein 6, CLIF, CYCLE-like factor, Member of PAS protein 9, MOP9, PAS domain-containing protein 9, PASD9, Transcription Factor BMAL2 | |
ARNTL2 | |
IgG | |
Affinity Purified | |
64 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title