Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Arrestin 3 Antibody, Novus Biologicals™

Name: Arrestin 3 Antibody, Novus Biologicals&trade;
Brand: Novus Biologicals
SKU: NBP16908320
Price: 204.00 USD

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP16908320UL

View more versions of this product

Catalog No. NBP16908320

$204.00 / Each of 1

Qty

Add to Cart

Description

Arrestin 3 Polyclonal specifically detects Arrestin 3 in Human samples. It is validated for Western Blot.

Specifications

Antigen	Arrestin 3
Classification	Polyclonal
Dilution	Western Blot 1:100-1:2000
Gene Alias	arrestin 3, retinal (X-arrestin), arrestin 4, arrestin-C, ARRXcArr, CAR, C-arrestin, Cone arrestin, Retinal cone arrestin-3, X-arrestin
Host Species	Rabbit
Molecular Weight of Antigen	43 kDa
Quantity	20 μL
Research Discipline	Cell Biology, Cellular Markers, GPCR, Neuroscience, Neurotransmission, Sensory Systems, Signal Transduction, Virology Bacteria and Parasites, Vision
Gene ID (Entrez)	407
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Symbols	ARR3
Immunogen	Synthetic peptides corresponding to ARR3 (arrestin 3, retinal (X-arrestin)) The peptide sequence was selected from the middle region of ARR3. Peptide sequence EDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPS.
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Isotype	IgG

Product Suggestions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Spot an opportunity for improvement?

Provide Content Correction

Arrestin 3 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions