Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARSH Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ARSH |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159370
|
Novus Biologicals
NBP159370 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ARSH Polyclonal specifically detects ARSH in Human samples. It is validated for Western Blot.Specifications
| ARSH | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| arylsulfatase family, member H, arylsulfatase H, ASH, EC 3.1.6, EC 3.1.6.-, EC 3.1.6.2, sulfatase | |
| ARSH | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q5FYA8 | |
| 347527 | |
| Synthetic peptides corresponding to ARSH(arylsulfatase family, member H) The peptide sequence was selected from the middle region of ARSH. Peptide sequence FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title