ART3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159931

Catalog No. NBP159931

Description

ART3 Polyclonal specifically detects ART3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ART3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: ART3
• Immunogen: Synthetic peptides corresponding to ART3(ADP-ribosyltransferase 3) The peptide sequence was selected from the middle region of ART3. Peptide sequence LEPTQIPAPGPVPVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVA.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Canine: 92%; Equine: 92%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: ADP-ribosyltransferase 3, EC 2.4.2.31, ecto-ADP-ribosyltransferase 3, FLJ26404, Mono(ADP-ribosyl)transferase 3, mono-ADP-ribosyltransferase, NAD(P)(+)--arginine ADP-ribosyltransferase 3, TMART
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 419
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.