Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ASAH3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | ASAH3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1742520
|
Novus Biologicals
NBP17412520UL |
20 μL |
Each for $152.22
|
|
NBP174125
|
Novus Biologicals
NBP174125 |
100 μL |
Each for $436.00
|
|
Description
ASAH3 Polyclonal specifically detects ASAH3 in Human samples. It is validated for Western Blot.Specifications
| ASAH3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8TDN7 | |
| 125981 | |
| Synthetic peptides corresponding to the C terminal of ACER1. Immunizing peptide sequence ITFPYGMVTMALVDANYEMPGETLKVRYWPRDSWPVGLPYVEIRGDDKDC. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Acylsphingosine deacylase 3, Alkaline CDase 1, alkaline ceramidase 1, AlkCDase 1, ALKCDase1, ASAH3, EC 3.5.1.23, MGC138327, MGC138329, N-acylsphingosine amidohydrolase (alkaline ceramidase) 3, N-acylsphingosine amidohydrolase 3 | |
| ACER1 | |
| IgG | |
| Affinity Purified | |
| 31 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title