Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ASB6 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15894520UL
Description
ASB6 Polyclonal specifically detects ASB6 in Human samples. It is validated for Western Blot.Specifications
ASB6 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q9NWX5 | |
ASB6 | |
Synthetic peptides corresponding to ASB6(ankyrin repeat and SOCS box-containing 6) The peptide sequence was selected from the middle region of ASB6. Peptide sequence LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV. | |
20 μL | |
Signal Transduction | |
140459 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ankyrin repeat and SOCS box containing 6, ankyrin repeat and SOCS box protein 6, ankyrin repeat and SOCS box-containing 6, ASB-6, FLJ20548, MGC1024 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title