Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ASB6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen ASB6
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126516
View Documents
Novus Biologicals
NBP31080725UL
25 μg
Each for $106.19
Add to cart
 
NB126515
View Documents
Novus Biologicals
NBP310807100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

ASB6 Polyclonal antibody specifically detects ASB6 in Human samples. It is validated for Western Blot
Specifications

Specifications

ASB6
Western Blot
Purified
RUO
Human
ankyrin repeat and SOCS box containing 6, ankyrin repeat and SOCS box protein 6, ankyrin repeat and SOCS box-containing 6, ASB-6, FLJ20548, MGC1024
The immunogen is a synthetic peptide directed towards the N terminal region of human ASB6 (NP_001189332.1). Peptide sequence SLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNAL
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Signal Transduction
PBS buffer, 2% sucrose
140459
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit