Abnova™ ASGR1 Recombinant Protein

Human full-length ORF recombinant protein with GST-tag at N-terminal

Supplier:  Abnova™ H00000432P0110

Catalog No. 89-009-904

Description

• Encoded by ASGR1 gene with asialoglycoprotein receptor 1
• Preparation method:in vitro wheat germ expression system
• Molecular weight: 57.75kDa
• Purification: glutathione sepharose 4 fast flow
• Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
• pH=8.0 in the elution buffer

Sequence: MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIGSQNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLE
DAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLL

Best when used within three months from the date of receipt.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

• Accession Number: AAH32130
• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Molecular Weight (g/mol): 58.1
• pH Range: 8
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quantity: 10 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Common Name: ASGR1
• Cross Reactivity: Human
• Recombinant: Recombinant
• Form: Solution

• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Gene ID (Entrez): 432
• Name: ASGR1 (Human) Recombinant Protein (P01)
• Preparation Method: In vitro wheat germ expression system
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Source: Wheat Germ (in vitro)
• Gene Alias: HL-1/ASGPR/ASGPR1/CLEC4H1
• Gene Symbol: ASGR1
• Species: Wheat Germ (in vitro)
• Protein Tag: GST