Asialoglycoprotein Receptor 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP185579

Catalog No. NBP185579

Description

Asialoglycoprotein Receptor 2 Polyclonal specifically detects Asialoglycoprotein Receptor 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Asialoglycoprotein Receptor 2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Accession No.: P07307
• Gene Symbols: ASGR2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKR
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 433
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ASGPR 2, ASGP-R 2, ASGPR2, ASGP-R2, asialoglycoprotein receptor 2, CLEC4H2FLJ60040, C-type lectin domain family 4 member H2, HBxAg-binding protein, HBXBP, Hepatic lectin H2, HL-2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only