Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Asialoglycoprotein Receptor 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $610.00
Specifications
| Antigen | Asialoglycoprotein Receptor 2 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Asialoglycoprotein Receptor 2 Polyclonal specifically detects Asialoglycoprotein Receptor 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Asialoglycoprotein Receptor 2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P07307 | |
| 433 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:YRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ASGPR 2, ASGP-R 2, ASGPR2, ASGP-R2, asialoglycoprotein receptor 2, CLEC4H2FLJ60040, C-type lectin domain family 4 member H2, HBxAg-binding protein, HBXBP, Hepatic lectin H2, HL-2 | |
| ASGR2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title