Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ASPRV1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ASPRV1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156511
|
Novus Biologicals
NBP156511 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ASPRV1 Polyclonal specifically detects ASPRV1 in Human samples. It is validated for Western Blot.Specifications
| ASPRV1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| aspartic peptidase, retroviral-like 1, EC 3.4.23.-, FLJ25084, retroviral-like aspartic protease 1, SASPaseMUNO, SASPTAPS, Skin aspartic protease, Skin-specific retroviral-like aspartic protease, Taps, TPA-inducible aspartic proteinase-like protein | |
| ASPRV1 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q53RT3 | |
| 151516 | |
| Synthetic peptides corresponding to SASP The peptide sequence was selected from the middle region of SASP. Peptide sequence RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title