Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Ataxin 1 Mouse anti-Human, Mouse, Rat, Clone: S76-8, Invitrogen™

Mouse Monoclonal Antibody

Manufacturer:  Invitrogen MA527666

Catalog No. PIMA527666


Add to cart

Description

Description

The autosomal domit cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. ADCAI is genetically heterogeneous, with five genetic loci, designated spinocerebellar ataxia (SCA) 1, 2, 3, 4 and 6, being assigned to five different chromosomes. ADCAII, which always presents with retinal degeneration (SCA7), and ADCAIII often referred to as the `pure ft. cerebellar syndrome (SCA5), are most likely homogeneous disorders. Several SCA genes have been cloned and shown to contain CAG repeats in their coding regions. ADCA is caused by the expansion of the CAG repeats, producing an elongated polyglutamine tract in the corresponding protein. The expanded repeats are variable in size and unstable, usually increasing in size when transmitted to successive generations. The function of the ataxins is not known. This locus has been mapped to chromosome 6, and it has been determined that the diseased allele contains 41-81 CAG repeats, compared to 6-39 in the normal allele, and is associated with spinocerebellar ataxia type 1 (SCA1). At least two transcript variants encoding the same protein have been found for this gene.
Specifications

Specifications

Ataxin 1
Monoclonal
1 mg/ml
PBS with 50% glycerol and 0.1% sodium azide; pH 7.4
P54253, P54254, Q63540
Ataxin-1, ATX1, Atxn1, D6S504E, OTTHUMP00000016065, SCA1, Spinocerebellar ataxia type 1 protein
Mouse
IgG2b
100 μg
-20°C
Primary
20238, 25049, 6310
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
S76-8
Unconjugated
ATXN1
Liquid
Atxn1
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Protein G
RUO
Antibody
Monoclonal
Human, Mouse, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit