Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Ataxin 1 Mouse anti-Human, Mouse, Rat, DyLight 350, Clone: S76-8, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP242186UV

Catalog No. NBP242186UV

Add to cart



Ataxin 1 Monoclonal antibody specifically detects Ataxin 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry.


Ataxin 1
Western Blot, Immunohistochemistry
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Protein G purified
Phospho Specific
Human, Mouse, Rat
Western Blot, Immunohistochemistry
DyLight 350
50mM Sodium Borate with 0.05% Sodium Azide
ataxin 1, ataxin 1), ataxin-1, ATX1spinocerebellar ataxia 1 (olivopontocerebellar ataxia 1, autosomal dominant, SCA1D6S504E, Spinocerebellar ataxia type 1 protein
0.1 ml
Store at 4C in the dark.
Detects approx 85kDa.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit