Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATG4B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | ATG4B |
---|---|
Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
Applications | Western Blot, Immunohistochemistry |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB126199
|
Novus Biologicals
NBP310649100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
ATG4B Polyclonal specifically detects ATG4B in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
ATG4B | |
Western Blot, Immunohistochemistry | |
Unconjugated | |
Rabbit | |
Autophagy, Cancer, Phospho Specific | |
PBS buffer, 2% sucrose | |
23192 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
Polyclonal | |
Purified | |
RUO | |
Human | |
APG4 autophagy 4 homolog B, APG4 autophagy 4 homolog B (S. cerevisiae), APG4B, ATG4 autophagy related 4 homolog B (S. cerevisiae), AUTL1MGC1353, AUT-like 1 cysteine endopeptidase, Autophagin-1, Autophagy-related cysteine endopeptidase 1, Autophagy-related protein 4 homolog B, cysteine protease ATG4B, DKFZp586D1822, EC 3.4.22, EC 3.4.22.-, hAPG4B, KIAA0943 | |
The immunogen is a synthetic peptide directed towards the N terminal region of human ATG4B (NP_037457). Peptide sequence WGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDS | |
Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title