Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ATG4B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen ATG4B
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Applications Western Blot, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126200
View Documents
Novus Biologicals
NBP31064925UL
25 μg
Each for $106.19
Add to cart
 
NB126199
View Documents
Novus Biologicals
NBP310649100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

ATG4B Polyclonal antibody specifically detects ATG4B in Human samples. It is validated for Western Blot, Immunohistochemistry
Specifications

Specifications

ATG4B
Western Blot, Immunohistochemistry
Purified
RUO
Human
APG4 autophagy 4 homolog B, APG4 autophagy 4 homolog B (S. cerevisiae), APG4B, ATG4 autophagy related 4 homolog B (S. cerevisiae), AUTL1MGC1353, AUT-like 1 cysteine endopeptidase, Autophagin-1, Autophagy-related cysteine endopeptidase 1, Autophagy-related protein 4 homolog B, cysteine protease ATG4B, DKFZp586D1822, EC 3.4.22, EC 3.4.22.-, hAPG4B, KIAA0943
The immunogen is a synthetic peptide directed towards the N terminal region of human ATG4B (NP_037457). Peptide sequence WGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDS
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Immunohistochemistry
Unconjugated
Rabbit
Autophagy, Cancer, Phospho Specific
PBS buffer, 2% sucrose
23192
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit